PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g56917.1.p
Common NameBRADI_3g56917, LOC100840827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 262aa    MW: 28654.1 Da    PI: 5.365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g56917.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.2e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++lv     +G  +W+++++  g+ R++k+c++rw +yl
  Bradi3g56917.1.p 14 KGPWTAEEDQKLVSFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding543.8e-1770111447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        + +E++l +d++ qlG++ W++Ia++++ gRt++++k++w+++
  Bradi3g56917.1.p  70 LSDDEEKLVIDLHSQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                       589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-21562IPR009057Homeodomain-like
PROSITE profilePS5129415.213961IPR017930Myb domain
SuperFamilySSF466894.49E-2711108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001671.09E-91661No hitNo description
PROSITE profilePS5129426.77262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2463117IPR009057Homeodomain-like
SMARTSM007176.4E-1566114IPR001005SANT/Myb domain
PfamPF002496.7E-1570111IPR001005SANT/Myb domain
CDDcd001678.33E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAE EDQKLVSFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDDEEKLVID LHSQLGNRWS KIAARLPGRT DNEIKNHWNT HIRKKLKKMG  120
IDPVTHQQLS LLKNQQQDHR HPEDPPKPSS QEPSSGAADE EEEEEEEAPM SAEQKQGTAC  180
SASSSAVLSP SSCSSSASAA TPGGADVDWP DPGDLFQVDT IMDMDWASIL SGTGSGGGDI  240
GGVDLLFDHC ADVGFDQQVW M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074831e-137AK107483.1 Oryza sativa Japonica Group cDNA clone:002-129-C06, full insert sequence.
GenBankFJ9402171e-137FJ940217.1 Oryza sativa Japonica Group clone KCS132B07 Myb related transcription factor mRNA, complete cds.
GenBankJX2359281e-137JX235928.1 Oryza sativa Japonica Group Myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570507.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX62e-82ODO1_PETHY; Protein ODORANT1
TrEMBLI1IEH70.0I1IEH7_BRADI; Uncharacterized protein
STRINGBRADI3G56917.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-83myb domain protein 20